Antibodies

View as table Download

Rabbit Polyclonal Anti-ANXA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ANXA3

Rabbit Polyclonal Anti-ANXA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the N terminal of human ANXA3. Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

Rabbit Polyclonal Anti-ANXA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the C terminal of human ANXA3. Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD

ANXA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human ANXA3 (NP_005130.1).
Modifications Unmodified

ANXA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human ANXA3 (NP_005130.1).
Modifications Unmodified