Antibodies

Jump to Filters
View as table Download
Protein atonal homolog 8 (ATOH8) Rabbit Polyclonal Antibody
TA306753

USD 430.00

2 Weeks

Rabbit Polyclonal ATOH8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATOH8 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human ATOH8.
Protein atonal homolog 8 (ATOH8) Rabbit Polyclonal Antibody
TA345460

USD 410.00

5 Days

Rabbit Polyclonal Anti-ATOH8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATOH8 antibody: synthetic peptide directed towards the N terminal of human ATOH8. Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL
Protein atonal homolog 8 (ATOH8) Rabbit Polyclonal Antibody
TA345461

USD 475.00

5 Days

Rabbit Polyclonal Anti-ATOH8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATOH8 antibody: synthetic peptide directed towards the C terminal of human ATOH8. Synthetic peptide located within the following region: LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE
Protein atonal homolog 8 (ATOH8) Rabbit Polyclonal Antibody
TA373795

USD 220.00

3 Weeks

ATOH8 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ATOH8.