Antibodies

View as table Download

Rabbit Polyclonal Anti-CBX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBX7 Antibody: synthetic peptide directed towards the middle region of human CBX7. Synthetic peptide located within the following region: ADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Rabbit Polyclonal Anti-CBX7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX7

CBX7 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX7