Antibodies

Jump to Filters
View as table Download
CBX7 Rabbit Polyclonal Antibody
TA335362

USD 375.00

5 Days

Rabbit Polyclonal Anti-CBX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBX7 Antibody: synthetic peptide directed towards the middle region of human CBX7. Synthetic peptide located within the following region: ADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
CBX7 Rabbit Polyclonal Antibody
TA352003

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBX7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX7
CBX7 Rabbit Polyclonal Antibody
TA367407

USD 380.00

4 Weeks

CBX7 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX7