Antibodies

View as table Download

Rabbit Polyclonal Anti-DRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DRG1 antibody: synthetic peptide directed towards the N terminal of human DRG1. Synthetic peptide located within the following region: LAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNL

Rabbit Polyclonal Anti-DRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DRG1 antibody: synthetic peptide directed towards the middle region of human DRG1. Synthetic peptide located within the following region: VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL

Rabbit Polyclonal Anti-DRG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DRG1

DRG1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DRG1

DRG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 158-367 of human DRG1 (NP_004138.1).
Modifications Unmodified