Antibodies

View as table Download

Rabbit Polyclonal GRIP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal GRIP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human GRIP1.

Rabbit Polyclonal Anti-GRIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIP1 antibody: synthetic peptide directed towards the C terminal of human GRIP1. Synthetic peptide located within the following region: RQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTP

GRIP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-950 of human GRIP1 (NP_001171545.1).
Modifications Unmodified

GRIP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GRIP1 (NP_001171545.1).
Modifications Unmodified