Antibodies

View as table Download

Rabbit Polyclonal Anti-IL3RA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL3RA

Goat Polyclonal Anti-IL3RA / CD123 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL3RA / CD123 Antibody: Peptide with sequence RQQYECLHYKTD, from the internal region of the protein sequence according to NP_002174.1; NP_001254642.1.

Rabbit polyclonal IL3RA Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA.

Rabbit Polyclonal Anti-IL3RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS

CD123 rabbit monoclonal antibody, clone DM31

Applications ELISA, FC
Reactivities Human
Conjugation Unconjugated

CD123 rabbit monoclonal antibody, clone DM33

Applications ELISA, FC
Reactivities Human
Conjugation Unconjugated

CD123 rabbit monoclonal antibody, clone DM34

Applications ELISA, FC
Reactivities Human
Conjugation Unconjugated

IL3RA Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL3RA (NP_002174.1).
Modifications Unmodified