Germany
Japan
United Kingdom
China
Rabbit anti-KCNJ11 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KCNJ11 |
Antibodies
View as table Download
Goat Polyclonal Antibody against Kcnj11 (Near N-terminal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ERRARFVSKKGNC, from the internal region (near the N Terminus) of the protein sequence according to NP_034732.1. |
Goat Polyclonal Antibody against KCNJ11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AEDPAKPRYRARQ, from the internal region (near the N Terminus) of the protein sequence according to NP_000516.3. |
Rabbit Polyclonal Anti-KCNJ11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KCNJ11 antibody is: synthetic peptide directed towards the middle region of HUMAN KCNJ11. Synthetic peptide located within the following region: SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLII |
Rabbit Polyclonal Anti-KCNJ11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNJ11 |
KCNJ11 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNJ11 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- KCNJ11
Isotypes
- IgG