Antibodies

Jump to Filters
View as table Download
Methionine Aminopeptidase 2 (METAP2) Rabbit Polyclonal Antibody
TA340142

USD 375.00

5 Days

Rabbit Polyclonal Anti-METAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METAP2 antibody: synthetic peptide directed towards the N terminal of human METAP2. Synthetic peptide located within the following region: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR
Methionine Aminopeptidase 2 (METAP2) Rabbit Polyclonal Antibody
TA378474

USD 220.00

3 Weeks

METAP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human METAP2 (NP_006829.1).
Modifications Unmodified