Antibodies

Jump to Filters
View as table Download
TH1L (NELFCD) Rabbit Polyclonal Antibody
TA344592

USD 475.00

5 Days

Rabbit Polyclonal Anti-TH1L Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TH1L antibody: synthetic peptide directed towards the N terminal of human TH1L. Synthetic peptide located within the following region: GEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLS
TH1L (NELFCD) Rabbit Polyclonal Antibody
TA379052

USD 220.00

3 Weeks

NELFCD Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 355-599 of human NELFCD (NP_945327.2).
Modifications Unmodified