Antibodies

Jump to Filters
View as table Download
PGD Rabbit Polyclonal Antibody
TA308104

USD 415.00

5 Days

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)
PGD Rabbit Polyclonal Antibody
TA313090

USD 345.00

In Stock

Rabbit polyclonal anti-PGD antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PGD.
PGD Rabbit Polyclonal Antibody
TA343269

USD 375.00

5 Days

Rabbit Polyclonal Anti-PGD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGD antibody is: synthetic peptide directed towards the N-terminal region of PGD. Synthetic peptide located within the following region: DFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGE
PGD Rabbit Polyclonal Antibody
TA379843

USD 220.00

3 Weeks

PGD Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 184-483 of human PGD (NP_002622.2).
Modifications Unmodified