Antibodies

Jump to Filters
View as table Download
PRIM1 Rabbit Polyclonal Antibody
TA314378

USD 345.00

In Stock

Rabbit polyclonal anti-PRIM1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human PRIM1.
PRIM1 Rabbit Polyclonal Antibody
TA338968

USD 310.00

5 Days

Rabbit Polyclonal Anti-PRIM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRIM1 antibody: synthetic peptide directed towards the N terminal of human PRIM1. Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM
Prim1 Rabbit Polyclonal Antibody
TA338969

USD 375.00

5 Days

Rabbit Polyclonal Anti-Prim1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Prim1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSD
PRIM1 Rabbit Polyclonal Antibody
TA380319

USD 220.00

3 Weeks

PRIM1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 121-420 of human PRIM1 (NP_000937.1).