Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC20A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC20A2 antibody: synthetic peptide directed towards the N terminal of human SLC20A2. Synthetic peptide located within the following region: DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

SLC20A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 235-485 of human SLC20A2 (NP_001244110.1).
Modifications Unmodified