Antibodies

Jump to Filters
View as table Download
SALF (STON1-GTF2A1L) Rabbit Polyclonal Antibody
TA347748

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-STON1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STON1 Antibody: A synthesized peptide derived from human STON1
SALF (STON1-GTF2A1L) Rabbit Polyclonal Antibody
TA329314

USD 310.00

5 Days

Rabbit Polyclonal anti-SALF antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-SALF antibody: synthetic peptide directed towards the C terminal of human SALF. Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD