Rabbit Polyclonal UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501). |
Rabbit Polyclonal UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501). |
Rabbit Polyclonal Anti-UBE2S Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2S antibody: synthetic peptide directed towards the N terminal of human UBE2S. Synthetic peptide located within the following region: NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE |
Rabbit Polyclonal Anti-UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBE2S |
UBE2S rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBE2S |
UBE2S Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 122-221 of human UBE2S (NP_055316.2). |
Modifications | Unmodified |