Rabbit Polyclonal Anti-ACOT11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACOT11 Antibody: synthetic peptide directed towards the middle region of human ACOT11. Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL |
Rabbit Polyclonal Anti-ACOT11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACOT11 Antibody: synthetic peptide directed towards the middle region of human ACOT11. Synthetic peptide located within the following region: YVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTE |
Anti-ACOT11 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
