Rabbit Polyclonal Anti-CCDC124 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CCDC124 Antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC124. Synthetic peptide located within the following region: VMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKV |
CCDC124 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-223 of human CCDC124 (NP_612451.1). |
| Modifications | Unmodified |
CCDC124 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-223 of human CCDC124 (NP_612451.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China