Rabbit Polyclonal Anti-CORO1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CORO1A antibody: synthetic peptide directed towards the N terminal of human CORO1A. Synthetic peptide located within the following region: MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALI |
Rabbit Polyclonal Anti-CORO1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CORO1A antibody: synthetic peptide directed towards the C terminal of human CORO1A. Synthetic peptide located within the following region: ELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLD |
Rabbit polyclonal CORO1A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CORO1A. |
Goat Polyclonal Antibody against Coronin 1 / TACO
| Applications | WB |
| Reactivities | HumannMouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRLDRLEETVQAK, from the C Terminus of the protein sequence according to NP_009005.1. |
Rabbit Polyclonal Anti-CORO1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CORO1A Antibody: synthetic peptide directed towards the C terminal of human CORO1A. Synthetic peptide located within the following region: TGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK |
Rabbit Polyclonal Anti-CORO1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CORO1A Antibody: synthetic peptide directed towards the middle region of human CORO1A. Synthetic peptide located within the following region: SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVS |
CORO1A rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CORO1A |
CORO1A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CORO1A |
CORO1A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 362-461 of human CORO1A (NP_001180262.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
