Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CKI-?1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CKI-?1. |
Rabbit polyclonal anti-Csnk1g1 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Csnk1g1 antibody: synthetic peptide directed towards the middle region of mouse Csnk1g1. Synthetic peptide located within the following region: FDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEV |
Rabbit polyclonal anti-CSNK1G1 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSNK1G1 antibody: synthetic peptide directed towards the middle region of mouse CSNK1G1. Synthetic peptide located within the following region: CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW |
CSNK1G1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 298-422 of human CSNK1G1 (NP_071331.2). |
| Modifications | Unmodified |
CSNK1G1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 298-422 of human CSNK1G1 (NP_071331.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CSNK1G1
Isotypes
- IgG