Antibodies

View as table Download

DYNC1LI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DYNC1LI2

Rabbit Polyclonal Anti-DYNC1LI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DYNC1LI2 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNC1LI2. Synthetic peptide located within the following region: KLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRD

DYNC1LI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DYNC1LI2

DYNC1LI2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DYNC1LI2
Modifications Unmodified