Antibodies

View as table Download

Rabbit Polyclonal Anti-EGR2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR2 Antibody: A synthesized peptide derived from human EGR2

EGR2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EGR2

Rabbit polyclonal EGR2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EGR2.

Rabbit Polyclonal Anti-EGR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR2 antibody: synthetic peptide directed towards the C terminal of human EGR2. Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG

Goat Polyclonal Antibody against EGR2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence HGTAGPDRKPFPC, from the internal region of the protein sequence according to NP_000390.2.

EGR2 (200-300) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

EGR2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EGR2

EGR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human EGR2 (NP_000390.2).
Modifications Unmodified

EGR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human EGR2 (NP_000390.2).
Modifications Unmodified

EGR2 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human EGR1/2. AA range:371-420