Rabbit Polyclonal Anti-EHD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EHD4 Antibody: synthetic peptide directed towards the middle region of human EHD4. Synthetic peptide located within the following region: LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA |
Rabbit Polyclonal Anti-EHD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EHD4 Antibody: synthetic peptide directed towards the middle region of human EHD4. Synthetic peptide located within the following region: KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT |
EHD4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 362-541 of human EHD4 (NP_644670.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
