Rabbit polyclonal ETV5 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ETV5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 8-36 amino acids from the N-terminal region of human ETV5. |
Rabbit Polyclonal Anti-ETV5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV5 antibody: synthetic peptide directed towards the N terminal of human ETV5. Synthetic peptide located within the following region: AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGA |
Rabbit Polyclonal Anti-ETV5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV5 antibody: synthetic peptide directed towards the N terminal of human ETV5. Synthetic peptide located within the following region: PFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLA |
Rabbit Polyclonal anti-ETV5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV5 antibody: synthetic peptide directed towards the N terminal of human ETV5. Synthetic peptide located within the following region: MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDL |
Germany
Japan
United Kingdom
China
