Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FBXO31 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FBXO31 Antibody: synthetic peptide directed towards the middle region of human FBXO31. Synthetic peptide located within the following region: QGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQ |
Rabbit Polyclonal Anti-FBXO31 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FBXO31 Antibody: synthetic peptide directed towards the middle region of human FBXO31. Synthetic peptide located within the following region: VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS |
Rabbit Polyclonal Anti-FBXO31 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FBXO31 |
FBXO31 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-539 of human FBXO31 (NP_079011.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FBXO31
Isotypes
- IgG