Antibodies

Jump to Filters
View as table Download
FTSJ1 Rabbit Polyclonal Antibody
TA331007

USD 375.00

5 Days

Rabbit polyclonal Anti-FTSJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FTSJ1 antibody: synthetic peptide directed towards the N terminal of human FTSJ1. Synthetic peptide located within the following region: MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA
FTSJ1 Rabbit Polyclonal Antibody
TA376372

USD 220.00

3 Weeks

FTSJ1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-329 of human FTSJ1 (NP_036412.1).
Modifications Unmodified