GABPB1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABPB1 |
GABPB1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABPB1 |
Rabbit Polyclonal Anti-GABPB2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the N terminal of human GABPB2. Synthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH |
Rabbit Polyclonal antibody to GABPB1 (GA binding protein transcription factor, beta subunit 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 395 of GABPB1 (Uniprot ID#Q06547) |
Goat Polyclonal Antibody against GABPB2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SSENSSKATDETG, from the internal region of the protein sequence according to NP_005245.2; NP_002032.2. |
Rabbit Polyclonal Anti-GABPB1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: PDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQ |
Rabbit Polyclonal anti-GABPB2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the middle region of human GABPB2. Synthetic peptide located within the following region: EPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQ |
Rabbit Polyclonal Anti-GABPB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: EEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEA |
Rabbit Polyclonal Anti-GABPB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: PDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQ |
Rabbit Polyclonal Anti-GABPB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABPB2 |
GABPB1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABPB1 |
GABPB1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABPB1 |
GABPB1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABPB1 |
GABPB1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 231-395 of human GABPB1 (NP_005245.2). |
Modifications | Unmodified |