Rabbit Polyclonal Anti-GDAP1L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GDAP1L1 antibody: synthetic peptide directed towards the N terminal of human GDAP1L1. Synthetic peptide located within the following region: ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT |
Rabbit Polyclonal Anti-Gdap1l1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Gdap1l1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Gdap1l1. Synthetic peptide located within the following region: FLGLSKKYWEDGSRPNLQSFFERVQRRLAFRKVLGDIHTTLLSAVIPNAF |
Germany
Japan
United Kingdom
China