Rabbit polyclonal anti-GRK7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRK7. |
Rabbit polyclonal anti-GRK7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRK7. |
Rabbit Polyclonal Anti-GRK7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRK7 antibody: synthetic peptide directed towards the C terminal of human GRK7. Synthetic peptide located within the following region: FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL |