Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-HES6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HES6. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Hes6 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hes6 Antibody is: synthetic peptide directed towards the middle region of Mouse Hes6. Synthetic peptide located within the following region: LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY |
Rabbit Polyclonal Anti-HES6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HES6 Antibody: synthetic peptide directed towards the C terminal of human HES6. Synthetic peptide located within the following region: PPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRP |
HES6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-224 of human HES6 (NP_061115.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HES6
Isotypes
- IgG