Rabbit Polyclonal Anti-HMGB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGB4 antibody: synthetic peptide directed towards the N terminal of human HMGB4. Synthetic peptide located within the following region: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWR |
Rabbit Polyclonal Anti-HMGB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGB4 antibody: synthetic peptide directed towards the C terminal of human HMGB4. Synthetic peptide located within the following region: WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRG |
Anti-HMGB4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China