Antibodies

View as table Download

Rabbit Polyclonal Anti-HOXC10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC10 antibody: synthetic peptide directed towards the N terminal of human HOXC10. Synthetic peptide located within the following region: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA

Rabbit Polyclonal Anti-HOXC10 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HOXC10

Rabbit polyclonal HOXC10 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HOXC10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 152-179 amino acids from the Central region of human HOXC10.

Rabbit polyclonal HOXC10 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HOXC10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 224-250 amino acids from the C-terminal region of human HOXC10.

Rabbit Polyclonal Anti-HOXC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC10 antibody: synthetic peptide directed towards the N terminal of human HOXC10. Synthetic peptide located within the following region: GSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAA

Rabbit Polyclonal Anti-HOXC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC10 antibody: synthetic peptide directed towards the middle region of human HOXC10. Synthetic peptide located within the following region: TPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAK

HOXC10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human HOXC10 (NP_059105.2).
Modifications Unmodified