Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-HOXC6 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human HOXC6. |
Antibodies
View as table Download
Rabbit polyclonal HOXC6 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HOXC6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-227 amino acids from the C-terminal region of human HOXC6. |
Rabbit Polyclonal anti-Hoxc6 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hoxc6 antibody is: synthetic peptide directed towards the middle region of Rat Hoxc6. Synthetic peptide located within the following region: DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQ |
Rabbit Polyclonal Anti-HOXC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXC6 antibody: synthetic peptide directed towards the C terminal of human HOXC6. Synthetic peptide located within the following region: KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE |
Rabbit Polyclonal Anti-HOXC6 Antibody
| Applications | IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXC6 antibody: synthetic peptide directed towards the C terminal of human HOXC6. Synthetic peptide located within the following region: KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE |
Rabbit Polyclonal Anti-HOXC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HOXC6 |
Active filters
Target Symbol
- HOXC6
Isotypes
- IgG