Antibodies

Jump to Filters
View as table Download
ITGA8 Rabbit Polyclonal Antibody
TA338225

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGA8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA8 antibody: synthetic peptide directed towards the N terminal of human ITGA8. Synthetic peptide located within the following region: GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
ITGA8 Rabbit Polyclonal Antibody
TA367724

USD 380.00

4 Weeks

ITGA8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGA8
ITGA8 Rabbit Polyclonal Antibody
TA377603

USD 220.00

3 Weeks

ITGA8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 907-1000 of human ITGA8 (NP_003629.2).
Modifications Unmodified