Antibodies

View as table Download

KCNA10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA10

Rabbit Polyclonal Anti-KCNA10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the middle region of human KCNA10. Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW

Rabbit Polyclonal Anti-KCNA10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10. Synthetic peptide located within the following region: DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI

KCNA10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA10

KCNA10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human KCNA10 (NP_005540.1).
Modifications Unmodified