Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal LIN28A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This LIN28A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-138 amino acids from the Central region of human LIN28A. |
Anti-LIN28A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa. 1~5 (M-G-S-V-S) derived from Human Lin28 |
Rabbit Polyclonal Anti-LIN28 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LIN28 Antibody: synthetic peptide directed towards the N terminal of human LIN28. Synthetic peptide located within the following region: GSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRM |
Rabbit Polyclonal Anti-LIN28A Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human LIN28A |
LIN28 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 142-209 of human LIN28 (NP_078950.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LIN28A
Isotypes
- IgG