Rabbit polyclonal antibody to MPP3 (membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 270 and 585 of MPP3 (Uniprot ID#Q13368) |
Rabbit Polyclonal antibody to MPP3 (membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 296 of MPP3 (Uniprot ID#Q13368) |
Rabbit Polyclonal Anti-MPP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPP3 antibody: synthetic peptide directed towards the N terminal of human MPP3. Synthetic peptide located within the following region: RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV |
Rabbit Polyclonal Anti-MPP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPP3 antibody: synthetic peptide directed towards the middle region of human MPP3. Synthetic peptide located within the following region: GVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCL |
Germany
Japan
United Kingdom
China
