Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-MRPS12 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MRPS12. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MRPS12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS12 antibody: synthetic peptide directed towards the N terminal of human MRPS12. Synthetic peptide located within the following region: LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK |
MRPS12 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-138 of human MRPS12 (NP_203527.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MRPS12
Isotypes
- IgG