Antibodies

Jump to Filters
View as table Download
MS4A7 Rabbit Polyclonal Antibody
TA331272

USD 375.00

5 Days

Rabbit Polyclonal Anti-MS4A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MS4A7 antibody is: synthetic peptide directed towards the middle region of Human MS4A7. Synthetic peptide located within the following region: TGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQ
MS4A7 Rabbit Polyclonal Antibody
TA378691

USD 220.00

3 Weeks

MS4A7 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A7 (NP_067024.1).
Modifications Unmodified