Antibodies

Jump to Filters
View as table Download
MSL2L1 (MSL2) Rabbit Polyclonal Antibody
TA329876

USD 375.00

5 Days

Rabbit Polyclonal Anti-MSL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSL2L1 antibody: synthetic peptide directed towards the N terminal of human MSL2L1. Synthetic peptide located within the following region: NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL
MSL2L1 (MSL2) Rabbit Polyclonal Antibody
TA378699

USD 220.00

3 Weeks

MSL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 328-577 of human MSL2 (NP_060603.2).
Modifications Unmodified