Rabbit Polyclonal Anti-NCKAP1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCKAP1L antibody: synthetic peptide directed towards the N terminal of human NCKAP1L. Synthetic peptide located within the following region: CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII |
Rabbit Polyclonal Anti-NCKAP1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCKAP1L antibody: synthetic peptide directed towards the C terminal of human NCKAP1L. Synthetic peptide located within the following region: LPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLK |
Germany
Japan
United Kingdom
China