Antibodies

View as table Download

Rabbit polyclonal anti-NDRG4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDRG4.

Rabbit Polyclonal Anti-NDRG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG4 antibody is: synthetic peptide directed towards the N-terminal region of Human NDRG4. Synthetic peptide located within the following region: EKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGN

Rabbit Polyclonal Anti-NDRG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG4 antibody is: synthetic peptide directed towards the C-terminal region of Human NDRG4. Synthetic peptide located within the following region: GYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTME

Anti-NDRG4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 332-346 amino acids of human NDRG family member 4

NDRG4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human NDRG4 (NP_001229765.1).
Modifications Unmodified