Antibodies

View as table Download

Rabbit Polyclonal Anti-NLRP2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRP2 antibody: synthetic peptide directed towards the C terminal of human NLRP2. Synthetic peptide located within the following region: FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA

Rabbit Polyclonal NALP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NALP2 antibody was raised against a peptide corresponding to 12 amino acids near the carboxy-terminus of human NALP2.

NBS1 Rabbit Polyclonal (C-Terminus) Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from human NLRP2 / NALP2.

NLRP2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human NLRP2 (NP_060322.1).
Modifications Unmodified