Antibodies

View as table Download

Rabbit Polyclonal Anti-PCBD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBD1 antibody: synthetic peptide directed towards the N terminal of human PCBD1. Synthetic peptide located within the following region: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFM

Rabbit Polyclonal Anti-PCBD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBD1 antibody: synthetic peptide directed towards the N terminal of human PCBD1. Synthetic peptide located within the following region: AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMT

PCBD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PCBD1

PCBD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PCBD1

PCBD1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human PCBD1 (NP_000272.1).
Modifications Unmodified