Antibodies

Jump to Filters
View as table Download
PCDH17 Rabbit Polyclonal Antibody
TA334984

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCDH17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDH17 antibody: synthetic peptide directed towards the C terminal of human PCDH17. Synthetic peptide located within the following region: SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK
PCDH17 Rabbit Polyclonal Antibody
TA379675

USD 220.00

3 Weeks

PCDH17 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 610-710 of human PCDH17 (NP_001035519.1).
Modifications Unmodified