Antibodies

Jump to Filters
View as table Download
PCOLCE Rabbit Polyclonal Antibody
TA337676

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCOLCE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCOLCE antibody: synthetic peptide directed towards the middle region of human PCOLCE. Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS
PCOLCE Rabbit Polyclonal Antibody
TA379703

USD 220.00

3 Weeks

PCOLCE Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-449 of human PCOLCE (NP_002584.2).
Modifications Unmodified