Germany
Japan
United Kingdom
China
PERP Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PERP antibody was raised against synthetic peptide from human PERP. |
Antibodies
View as table Download
Rabbit Polyclonal PERP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PERP antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human PERP, which differ from the mouse sequence by three amino acids (7-9) . |
Goat Polyclonal Antibody against PERP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CLPNYEDDLLGNAK, from the C Terminus of the protein sequence according to NP_071404.2. |
Rabbit Polyclonal Anti-PERP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PERP antibody: synthetic peptide directed towards the middle region of human PERP. Synthetic peptide located within the following region: FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG |
PERP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PERP (NP_071404.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PERP
Isotypes
- IgG