Antibodies

View as table Download

Rabbit Polyclonal Anti-PTH2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTH2R antibody is: synthetic peptide directed towards the C-terminal region of Human PTH2R. Synthetic peptide located within the following region: NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED

PTHR2 / PTH2R Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen PTHR2 / PTH2R antibody was raised against synthetic 20 amino acid peptide from 1st extracellular domain of human PTH2R / PTHR2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (95%).

PTHR2 / PTH2R Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen PTHR2 / PTH2R antibody was raised against synthetic 17 amino acid peptide from C-terminus of human PTH2R / PTHR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Marmoset (88%); Bovine, Panda (82%).

PTH2R Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-145 of human PTH2R (NP_005039.1).
Modifications Unmodified