Antibodies

View as table Download

Rabbit Polyclonal Anti-RAPGEF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF6 antibody is: synthetic peptide directed towards the N-terminal region of Human RAPGEF6. Synthetic peptide located within the following region: GSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPA

RAPGEF6 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAPGEF6 (NP_001157858).