Antibodies

View as table Download

Rabbit Polyclonal Anti-RHOT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RHOT1 antibody was raised against a 15 amino acid peptide near the amino terminus of human RHOT1.

Rabbit Polyclonal Anti-RHOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOT1 Antibody: synthetic peptide directed towards the middle region of human RHOT1. Synthetic peptide located within the following region: ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR

RHOT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 310-590 of human RHOT1 (NP_060777.3).
Modifications Unmodified