Antibodies

Jump to Filters
View as table Download
SLC22A12 Rabbit Polyclonal Antibody
TA333516

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC22A12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC22A12 Antibody: synthetic peptide directed towards the N terminal of human SLC22A12. Synthetic peptide located within the following region: SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR
SLC22A12 Rabbit Polyclonal Antibody
TA351468

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC22A12 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC22A12
SLC22A12 Rabbit Polyclonal Antibody
TA367164

USD 380.00

4 Weeks

SLC22A12 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC22A12
SLC22A12 Rabbit Polyclonal Antibody
TA381577

USD 220.00

3 Weeks

SLC22A12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-150 of human SLC22A12 (NP_653186.2).
Modifications Unmodified