Antibodies

Jump to Filters
View as table Download
SNX18 Rabbit Polyclonal Antibody
TA308603

USD 415.00

5 Days

Rabbit Polyclonal antibody to SNX18 (sorting nexin 18)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 566 and 628 of SNX18 (Uniprot ID#Q96RF0)
SNX18 Rabbit Polyclonal Antibody
TA331679

USD 375.00

5 Days

Rabbit Polyclonal Anti-SNX22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNX22 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNX22. Synthetic peptide located within the following region: LEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALH
SNX18 Rabbit Polyclonal Antibody
TA340215

USD 375.00

5 Days

Rabbit Polyclonal Anti-SNX18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNAG1 antibody: synthetic peptide directed towards the N terminal of human SNAG1. Synthetic peptide located within the following region: LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD
SNX18 Rabbit Polyclonal Antibody
TA381858

USD 220.00

3 Weeks

SNX18 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 445-624 of human SNX18 (NP_001096045.1).
Modifications Unmodified